PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000083G1570
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 346aa    MW: 37729 Da    PI: 9.3358
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000083G1570genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-2487131145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  PH01000083G1570  87 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 131
                      79****************************************986 PP

2QLQ62.61e-211650236
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                      FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++i+
  PH01000083G1570 16 VFTAAQWAELEQQALIYKYLMAGAPVPPDLLLPIR 50
                     5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-111551IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.4331651IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.3E-161750IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.34687131IPR014977WRC domain
PfamPF088793.9E-2188130IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MGMGGYQQQQ QQRAAVFTAA QWAELEQQAL IYKYLMAGAP VPPDLLLPIR PNSAAATFSF  60
ANPAASPFYH HHHPSLSYYA YYGKKLDPEP WRCRRTDGKK WRCSKEAHPD SKYCERHMHR  120
GRNRSRKPVE SKTAAPAPQP QPQLSTVTTT TRDTAPLPSL AVGGKTHGLS LGGAGSSQVH  180
FDSSSYGGKY SPGAKADVGE LSFFSGASGN TRGFTIDSPT DSSWHSLPSS VPPYPLSKTR  240
DSGLLPGAYS YSYLEPSQEL GQVTIASLSQ EQERHSFSGR AGGLLGNVKH ENQPLRPFFD  300
EWPGTRDSWS EMDDERSNRT SSSTTQLSIS IPMPRCGSPI GRPLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641602.10.0PREDICTED: growth-regulating factor 5 isoform X1
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLI1PYZ00.0I1PYZ0_ORYGL; Uncharacterized protein
STRINGLOC_Os06g02560.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.16e-29growth-regulating factor 5